PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 752aa    MW: 85263.6 Da    PI: 5.5456
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758867.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS367.81.5e-1123797501374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++l+++cA+av+++d + a +lL+++++++ p gd +qRla++f+ +L+arla+++s++ykal  ++ts    ++ l+a++l+   +P+ k+s 
  XP_009758867.1 379 LRTLMINCAQAVAADDSKSAYELLKQIRQHSYPFGDGNQRLAHCFADGLEARLAGTGSQIYKALVNKRTS---AADLLKAYHLYLASCPFRKISS 470
                     57899***********************************************************999998...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++ N++I+  +e+++rvH+iDf+i +G+QWp+++q +a+R++gpp+lRiTg++ p++g   +e++ee g+rLa++A++++vpfe+++ +ak++e+
  XP_009758867.1 471 FASNKTIMIKAENATRVHVIDFGILYGFQWPTFIQRIAEREGGPPKLRITGIEFPQPGfrPAERIEESGRRLADYARSFNVPFEYHA-IAKKWET 564
                     *********************************************************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++++L+++++E laV + ++ ++l+de+v  +s r+ vL+l+++++P+++++   +  ++s+ F++rf eal ++salfd+le+ +pre  er 
  XP_009758867.1 565 ITVDDLKLDKDEFLAVTCLYRFKNLYDETVVADSSRTVVLNLIRKINPDIFIHGIVNGAYSSPFFVTRFREALFHFSALFDMLETIVPREIPERG 659
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +Ere++gre+ nv+aceg er+er et+++W+ r+  a F+++p++ + +++a   +r  + + + ++e+s++l+lgWk+r+++++S+W+
  XP_009758867.1 660 LIEREIFGREALNVIACEGWERVERPETYKQWQVRILGARFTQIPFEREFVNKAVEKVRLGYHRDFVIDEDSQWLLLGWKGRTIYAISCWK 750
                     ************************************************************99999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.378353730IPR005202Transcription factor GRAS
PfamPF035145.3E-110379750IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MDPRFNGNPS SLSDFRLGNQ SFPISSDGRM INGPRFELIY PDQKLHNGPR LENSFVQHNF  60
GGVGCINGDR LPSNLESRSD LGGVEEDFNE DIDFSDVVLS YINQMLMEEE MEDKTDMLQE  120
SLELQAKEKT FYEALGKKYP PSPEQNAFTN QYNESPDDYF SGSIYNSTSN TSENSGNLVD  180
SRAVNISTDY NSAYVEGLSF RNTSVCSSNS GNTIVDGFLD SPVSSFHIPD IYNESQSIWS  240
FRKGVEEASK FLPTNNKLLN NDLPSLESKG EAGYVEKKDE GETSPTEARG RKNPQRDDNY  300
TEEERSSKQA AIFTESTLRS EEFDIVLLHS MGKGEEALEA YRQNLRNAKS KTTVQIPKGS  360
KGGKGRGKKQ GGKKEVIDLR TLMINCAQAV AADDSKSAYE LLKQIRQHSY PFGDGNQRLA  420
HCFADGLEAR LAGTGSQIYK ALVNKRTSAA DLLKAYHLYL ASCPFRKISS FASNKTIMIK  480
AENATRVHVI DFGILYGFQW PTFIQRIAER EGGPPKLRIT GIEFPQPGFR PAERIEESGR  540
RLADYARSFN VPFEYHAIAK KWETITVDDL KLDKDEFLAV TCLYRFKNLY DETVVADSSR  600
TVVLNLIRKI NPDIFIHGIV NGAYSSPFFV TRFREALFHF SALFDMLETI VPREIPERGL  660
IEREIFGREA LNVIACEGWE RVERPETYKQ WQVRILGARF TQIPFEREFV NKAVEKVRLG  720
YHRDFVIDED SQWLLLGWKG RTIYAISCWK PV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-463837508375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758867.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_016434704.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM1AHK30.0M1AHK3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000229960.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein